1. In lecture (Chapter 15) we discussed how proteins are translocated to their t
ID: 80935 • Letter: 1
Question
1. In lecture (Chapter 15) we discussed how proteins are translocated to their target location/organelle after being folded in the ER. The primary sequence (in one-letter symboll of a protein below. The N-terminal & Cterminal regions are highlighted in blue. Based on your understanding about various types of signaling sequences that direct proteins to their destinations, determine where this protein will be trans! to and happen to the signaling sequence after the protein is properly translocated to its destination? Explain your answer. IHint: Refer to Fig. 4.3 of Chapter 4 or lecture note 4 for amino acid symbols and side chain properties] +H,NMRSSATLLSRVAVLGAAGGIGQPLSLLLKCSPLvTDLSLYDIRGGTGVAADLFHIPSPAEVIGFASDELEK AVKGADLVLVAAGI PRKPGMTRDD LFNTNAGIVRDLVTAVARAAPKAllGVISNPVNSTVPWAAETUK KLGAY DPGR LFGVTTLDVVRARTFVAEALGRSPYDIDV PVVGGHSGETIVPLI SGFPSLSKE QVEQLTY RIQFGGDEW KAKAGKGSATLSMAYAAASDWSTSILKALRGDKGIAEYAFVENDLQQPHCHFFGCAVELGTHGVERVLPIPAL NAYEQQLLDA CVPALSAELRKGvDFAVKTHL'TPDCCOOExplanation / Answer
Answer 1:Protein translocation is the movement of proteins in the cellular membrane and these movements are not random but are targeted. Protein targeting or protein sorting depends on the composition of protein itself and is a very crucial in the translocation movement. In case of errors in translocation the result can be in the form of diseases. The sequence of amino acids in the above questions shows the S-L-L(position 25,26 and 27) this indicates that it will be translocated into peroxisomes.
During translocation into peroxisomes the following occurs:
2.answer is C.
explanation in brief:In vivo studies have shown that posttranslational modifications have to occur for the GP to be recognised.Therefore the GP1 has to further undergo modifications before it gets recognised by the human immune cell.
3. Answer is B
Explanation: Nitric oxide,NO acts as rapid smooth muscle relaxant in the absence of Ach as described in the following steps
Related Questions
Navigate
Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.