| Question Completion Status QUESTION1 You have a mixture of Protein A, Protein
ID: 717406 • Letter: #
Question
| Question Completion Status QUESTION1 You have a mixture of Protein A, Protein B, and Protein C. You wish to isolate (purify) protein B from this mixture. The protein mixture is in a buffered solution at pH 6.5. The properties of each protein are shown below. Which chromatography approach would be the most appropriate to use? ein ar ht 1 kDa 30.0 kDa 4.3 Nickel Affinity Chromatography lon Exchange Chromatography Size Exclusion Chromatography QUESTION 2 Find the best match y Structure A. A particular region of a protein acquires a ß-sheet conformation in order to maximize backbone Secondary Structure hydrogen bonding and minimize steric clashes among side chains B. GFWEEFESLQKQEVKNLHORLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPG C. The overall structure of Protein X consists of 5 a-helices and 4 -sheets. A zinc finger motif Tertiary Structureformed by the side chains of cysteine residues helps stabilize this structure. C. The overall st -:Quaternary D. Hemoglobin assembles into a heterotetramer that consists of 2 a globin and 2 p globin subunits. The heterotetramer is stabilized by salt bridges between subunits. Click Save and Submit to save and submit. Click Save All Answers to save all answers.Explanation / Answer
Answer:-
1. Ion exchange chromatography as there are differences in the pH.
2. B:- primary structure
A:- Secondary Structure
C:- Tertiary Structure
D:- Quaternary
3. True as binding of oxygen is oxidation
4. All of the above.
Related Questions
Navigate
Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.