i want to write c++ code that accepts two input sequences based on fasta format.

Question

i want to write c++ code that accepts two input sequences based on fasta format. Fasta stands for"Fast All" which is the generalization of "Fast Protein" . it is commonly used format to store sequences either protein or DNA/RNA.A sequence in FASTA format begins with a single-line description, including the name of gene, the starting position of the gene. followed by lines of sequence data. The description line (defline) is distinguished from the sequence data by a greater-than (">") symbol at the beginning in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence in FASTA format is:         >gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED)        QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE        KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS        VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP        FLFLIKHNPTNTIVYFGRYWSP

Explanation / Answer

Hello Friend, gone through full unfortunate story. I personally feel that you must be acting professionally always with any and every client. It was this which made above story.

Well now you are experienced, and have made contract which will include the above points, I would like to suggest following points

1. Include the minimum time required to develop the perticular Site (according to project)

2. Include when the client will get first prototype and there after increments of site.

All the Best...

Related Questions

Navigate

• Browse (All)
• Browse I
• Subjects

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.