You sequence a new organism and identify the gene sequence below but have no ide

Question

You sequence a new organism and identify the gene sequence below but have no idea what its function is. Use at least two publicly available web tools to predict the function of the gene product below. What does it match to, and how well does it match? Are there any conserved domains? What do those domains do? Specifically please note the most likely Gene Ontology terms that would be assigned to this protein. Describe your procedure and interpret your results.

>Unknown protein DKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNL

Explanation / Answer

Used Basic Local Alignment Search Tool (BLAST)- blastp algorithm.

The Basic Local Alignment Search Tool (BLAST) finds regions of local similarity between sequences, which can be used to infer functional relationships between sequences.

The sequence matches 100% to a portion of protein sequence of small t antigen from Murine polyomavirus and Mus musculus

DnaJ domain - DnaJ (hsp40) binds to dnaK (hsp70) and stimulates its ATPase activity, generating the ADP-bound state of dnaK, which interacts stably with the polypeptide substrate.

Gene Ontology:

GO:0005524; ATP binding ( dnaJ )
GO:0005737; cytoplasm ( dnaJ )
GO:0006260; DNA replication ( dnaJ )
GO:0006457; protein folding ( dnaJ )
GO:0006950; response to stress ( dnaJ )
GO:0008270; zinc ion binding ( dnaJ )
GO:0009408; response to heat ( dnaJ )
GO:0031072; heat shock protein binding ( dnaJ )
GO:0046872; metal ion binding ( dnaJ )
GO:0051082; unfolded protein binding ( dnaJ )

Related Questions

Navigate

• Browse (All)
• Browse Y
• Subjects

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.