3. (1.5 points) Below is the sequence of the beta subunit of hemoglobin and its

Question

3. (1.5 points) Below is the sequence of the beta subunit of hemoglobin and its gene sequence. Follow the directions below:

Human hemoglobin beta chain

protein sequence:

                   /translation="MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRLFE                             SFGDLFTPDAVMGNPKVKAHGKKVLGAFSDGPAHLDNLKGTFATLSELHCDKLHVDPE

        NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH"

DNA sequence, with T's substituted for U's.

        1 acatttgctt ctgacacaac tgtgttcact agcaacctca aacagacacc atggtgcacc

       61 tgactcctga ggagaagtct gccgttactg ccctgtgggg caaggtgaac gtggatgaag

      121 ttggtggtga ggccctgggc aggctgctgg tggtctaccc ttggacccag aggctctttg

      181 agtcctttgg ggatctgttc actcctgatg ctgttatggg caaccctaag gtgaaggctc

      241 atggcaagaa agtgctcggt gcctttagtg atggcccggc tcacctggac aacctcaagg

      301 gcacctttgc cacactgagt gagctgcact gtgacaagct gcacgtggat cctgagaact

      361 tcaggctcct gggcaacgtg ctggtctgtg tgctggccca tcactttggc aaagaattca

      421 ccccaccagt gcaggctgcc tatcagaaag tggtggctgg tgtggctaat gccctggccc

      481 acaagtatca ctaagctcgc tttcttgctg tccaatttct attaaaggtt cctttgttcc

      541 ctaagtccaa ctactaaact gggggatatt atgaagggcc ttgagcatct ggattctgcc

      601 taataaaaaa catttatttt cattgaaaaa aaaaaaaaaa aaaaaaa

DIRECTIONS: Start in line 2, nt 61. Use the Genetic code to TRANSLATE the sequence starting at nt 61 in all three possible reading frames in the shaded region. Translate for thirty or so nucleotides (61-90). ONE of the reading frames matches the amino acid sequence of the protein. Circle the correct reading frame and circle where in the protein translation sequence this matches. The OTHERS do NOT match and probably have stop codons in them. It is okay to write on the bottom of the page or the back. Look at the example from the slide in class. Look in this sequence for “out of frame” stop codons. These are UAA (TAA), UAG (TAG) and UGA (TGA). Circle a few of these and label. These do NOT count as stop codons because they are NOT in frame with the AUG that starts translation. This is an important concept.

Explanation / Answer

1st frame: Stop L L R R S L P L L P C G

2nd frame: D S Stop G E V C R Y C P V G

3rd frame: T P E E K S A V T A L W

MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRLFE SFGDLFTPDAVMGNPKVKAHGKKVLGAFSDGPAHLDNLKGTFATLSELHCDKLHVDPE

This is where the sequences matches.

acatttgcttctgacacaac tgtgttcactagcaacctcaaacagacaccatggtgcacctgactcctga ggagaagtctgccgttactgccctgtgggg caaggtgaacgtggatgaagttggtggtgaggccctgggcaggctgctggtggtctacccttggacccagaggctctttgagtcctttggggatctgttc actcctgatgctgttatgggcaaccctaaggtgaaggctcatggcaagaa agtgctcggtgcctttagtgatggcccggctcacctggac aacctcaagggcacctttgccacactgagtgagctgcactgtgacaagctgcacgtggatcctgagaact

The stop codons are made in bold and underlined.

Related Questions

Navigate

• Browse (All)
• Browse 3
• Subjects

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.