Academic Integrity: tutoring, explanations, and feedback — we don’t complete graded work or submit on a student’s behalf.

a) How many transmembrane alpha helices do you believe this protein could have?

ID: 216259 • Letter: A

Question

a) How many transmembrane alpha helices do you believe this protein could have? Indicate the residue numbers of each of those transmembrane helices or that no transmembrane helices are likely to be present.

b) Assuming that the N-terminus of this protein is in the cytoplasm, which amino acids (give residues and their numbers) have the potential to carry O-linked oligosaccharides?

9. You have just sequenced the gene that encodes the protein bosshartinase. The predicted primary structure of the protein is shown below. The numbers indicate residue numbers in the primary structure and are provided for your convenience in conveying your answer. 10 20 30 40 MNTKDPRPEG ITLIIFVMAVIVLLAIWVVLNNDERYKKSH 41 50 60 70 80 SDVPLTVNMLKGG PRNKLVC HTGYGYILILLITGIVAMAV 81 90 100 110 115 FIIFLIDEPH HALQVRGETEEDPYCVVALQKCCLIL a. How many transmembrane a helices do you believe this protein could have? Indicate the residue numbers of each of those transmembrane helices or that no transmembrane helices are likely to be present. b. Assuming that the N-terminus of this protein is in the cytoplasm, which amino acids (give residues and their numbers) have the potential to carry O-linked oligosaccharides?

Explanation / Answer

a) Transmembrane helices are formed by non polar or hydrophobic amino acids, in the given amino acid sequence two transmembrane helices will be formed -

b) O-linked glycosylation occurs in the golgi cisternae. In this, O-linked oligosaccharides are linked to the hydroxyl group of either serine or threonine via N-acetylgalactosamine or to the hydroxyl groups of hydroxylysine via galactose.

Threonine at position 73 will be O-linked glycosyslated