peyton rous was a relatively young man when in 1911 he discovered a virus that c

Question

peyton rous was a relatively young man when in 1911 he discovered a virus that causes sarcomas in chickens. the virus was named rous sarcoma virus(RSV). later it was found that RSV is a retrovirus taht contains an oncogene,vsrc, in its rna genome. perform pairwise global alighments with the needleman-wunsch algorithm between v-src protein and the following proteins: chikcen c-src, human c-src, and mouse c-src proteins. The c prefix is short for cellular. sometimes proto-oncogenes are distinguished from viral oncogenes with the prefix c and v respectively. report the identities for each pair wise alighment. given what you know about the origin of v-src, does the result match your expectations? use the schmidt-ruppin a strain of RSV as your source for the v-src sequence

Explanation / Answer

Ans:

Showed 94% similarity with Chicken

Showed 88% similarity with Human

Showed 87% similarity with Mouse

From this we can assume/ascertain that RSV V-SRC originated or closely related to Chicken showing 94% alignment sequence similarity. Yes results matched the expectation that RSV has been originated from chicken

Go to this page and copy paste the following sequences (in the top window RSC sequence in the bottom window chicken, human and mouse one at a time and push the button align@down and you can see the result page with all the information)

https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&PROG_DEF=blastn&BLAST_PROG_DEF=blastn&BLAST_SPEC=GlobalAln&LINK_LOC=BlastHomeLink

The FASTA format sequences for all given below

schmidt-ruppin a strain of RSV v-src sequence:

>sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) OX=270623 GN=V-SRC PE=1 SV=3

MGSSKSKPKGPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL

FGDFNTSDTVTSPQRAGALAGGVTTFVALYDYESWIETDLSFKKGERLQIVNNTEGNWWL

AHSVTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT

KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR

LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG

TMSPEAFLQEAQVMKKLRHKKLVQLYAVVSEEPIYIVIEYMSKGSLLDFLKGEMGKYLRL

PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ

GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMGNGEVLDRVERGYR

MPCPPECPESLHDLMSQCWRRDPEERPTFEYLQAQLLPACVLEVAE

chikcen c-src:

Mouse c-src:

Related Questions

Navigate

• Browse (All)
• Browse P
• Subjects

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.